Predict Protein Structure with AI (Python Tutorial) | Bioinformatics Project | CodeVisium #AI

Proteins are the building blocks of life, and understanding their structure is critical for: Drug discovery Disease research Vaccine development Molecular biology In this tutorial, we build a simple AI pipeline for protein analysis using Python. You can run this in: Google Colab Jupyter Notebook Kaggle Tools used: Python BioPython scikit-learn NumPy Matplotlib Step 1: Install Libraries pip install biopython scikit-learn numpy matplotlib Step 2: Load Protein Sequence Example protein sequence: from Bio.Seq import Seq protein = Seq("MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGE") print("Protein Length:", len(protein)) print("Sequence:", protein) Step 3: Extract Simple Features Convert sequence into numerical features. import numpy as np amino_acids = "ACDEFGHIKLMNPQRSTVWY" def encode_sequence(seq): return [seq.count(aa) for aa in amino_acids] features = encode_sequence(str(protein)) print(features) This creates numerical features for machine learning. Step 4: Train Machine Learning Model Example classification model. from sklearn.ensemble import RandomForestClassifier X = [features] y = [1] # Example label model = RandomForestClassifier() model.fit(X, y) Step 5: Predict New Protein new_seq = "MKADTLK" new_features = encode_sequence(new_seq) prediction = model.predict([new_features]) print("Prediction:", prediction) AI can now analyze protein sequences computationally. Step 6: Visualize Amino Acid Distribution import matplotlib.pyplot as plt plt.bar(amino_acids, features) plt.title("Amino Acid Distribution") plt.show() Real-World Applications This technique helps with: Protein function prediction Drug target discovery Disease mutation analysis Synthetic biology design Vaccine development AI models like AlphaFold have revolutionized protein structure prediction. 5 Interview Questions and Answers Q1. Why is protein structure prediction important? A1. Protein structure determines biological function and drug binding. Q2. Which A